
Concept of karma. Woman holding images of spheres and pink smoke on color background, closeup
Stock Photo ID: 996764
Large 6984 × 3683 px, JPG 246.38 × 129.93 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Concept of karma. Woman holding images of spheres and pink smoke on color background, closeup”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 6984 × 3683 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 19 Sep 2022
You may use our image “Concept of karma. Woman holding images of spheres and pink smoke on color background, closeup” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
abstractadultasiabackgroundbalancebeliefblurredbokehbuddhismchangecloseupcolorcolorfulconceptconsequencesdestinyeasteffectfairyfatefemalehandharmonyhinduismholdingideaillustrationimageskarmakarmiclifelifestylepersonphilosophypinkrebirthreincarnationreligionsanskritshinysmokesoulsparklespheresspiritspiritualspiritualityvioletwomanyoung
Africa Images: perfect photos for all your business and project needs
Africa Images is a leading high-quality stock photography provider. We change our collections every day by keeping track of trends and making sure current images are of interest to our valued customers. With a team of professionals, including designers, retouchers, and models working on photo shoots, attention is paid to every detail of the image down to the furniture, technology, and food shown. High-resolution images are extremely important for your marketing, advertising, business ventures or other commercial activities to convey a professional and credible reputation. Our royalty-free stock images will help you develop a positive corporate image, leading to increased sales.
Create visual resonance for your brand with royalty-free images
Visual resonance is when you make a person feel that they are in the image or fully experiencing it. When achieved, brand resonance can create an unprecedented level of advocacy among consumers who become not only buyers but also promoters and fans of the brand. A positive experience will help in laying a foundation for the establishment of long-lasting relationships with your brand. With an extensive collection of high-quality images available on our site, your visuals can portray the desired message to your targeted audience. Get your audience to be curious, and they will stay interested in your business for the long term.
Let our quality image collections motivate your creativity
Embark on a visual tour of our many stock photo categories that bring out the unique aspects of everyday and not-so-everyday life. No matter what theme you are working on, or what idea you have in your mind, we will have a suitable image to fit your requirements in one of our extensive collections. From the most popular and trending categories to the daily essentials, these categories are regularly updated so that your materials are always up to date and stand out in a crowded marketplace. We celebrate the beauty of life with our diverse and carefully curated collections.
Get diverse pictures and extra advantages with our photo stock
Explore stock images and much more on our popular platform. Daily content updates mean you can benefit from the latest pictures, with a selection that is unique to this site alone. Feel free to explore the large variety of free images in our gallery that covers in-demand topics like pets, holidays, cooking, and nature. Whether you are looking for a specific image or just for inspiration, there will be a suitable image available to satisfy your creative requirements. Additionally, we have a blog that gives useful tips on how to utilize your newly downloaded stock photos in advertising campaigns or marketing products for both commercial and non-commercial organizations.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
Get more value for your money with our on-demand stock image packs
Use our license comparison table to choose exactly what you need when it comes to our image pricing plans. It helpfully sets out what usage is allowed with each plan so you can select a package that works for your project needs. You can save time and money with our bulk savings on both the Standard and Extended options, with discounts on offer for the more photos you purchase. Looking to do more with your downloads when it comes to sales and distribution? Only our Extended license allows the use of our image content in the creation of any product for sale or distribution, digital templates for sale and distribution, and for business or commercial space designs.