Composition with CBD oil, THC tincture and hemp leaves on wooden table, flat lay. Space for text
Stock Photo ID: 765070
Large 6522 × 4348 px, JPG 230.08 × 153.39 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Composition with CBD oil, THC tincture and hemp leaves on wooden table, flat lay. Space for text”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 6522 × 4348 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 6 Jul 2021
You may use our image “Composition with CBD oil, THC tincture and hemp leaves on wooden table, flat lay. Space for text” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
alternativeanxietybackgroundbeautybodybottlecalmingcannabidiolcannabinoidcannabiscarecbdcompositioncopycosmeticcreamdropperdrugeffectextractflatgreenhealthhemplayleaveslegalizelotionmarijuanamedicalmedicinenaturalnatureobjectoilorganicpillplantproductskinspacestresssupplementtabletextthctincturetopviewwooden
Create memorable and engaging creative projects with Africa Images
Our goal at Africa Images is to create and supply exceptional stock images that will enhance your brand’s reputation. If you are a business owner or marketer, you understand that your advertising efforts require high-quality photography that can be used royalty-free in your creative campaigns. We can provide a range of sizes and resolutions, alongside a huge supply of themes and collections to ensure you find the perfect image. With additional benefits and service features, including free images, sharing previews, and unlimited downloads, now is the ideal time to enhance your brand visibility, drive engagement, and ultimately boost your sales.
Learn how creators can navigate the image landscape responsibly
In an increasingly visual world, high-quality photos and illustrations are always in high demand. Content creators such as bloggers, marketers, and designers can greatly benefit from using stock photos, which can significantly enhance your projects. With our vast archive of ready-made images, using our services is one of the best ways to legally use licensed photos for your campaigns. These royalty-free images are cleared for commercial and non-commercial use and can be used across industries and creative formats such as billboards, social media, stationery, websites, and signage. Consider us as your visual partner in navigating the image landscape responsibility to boost your business opportunities.
Visual brilliance awaits exploration with our photo collections
Our image catalogs comprise over a million stock pictures that are frequently updated so you can browse through the latest photos on different topics, including trending categories such as interior design, home décor, salons and spas, business, and happy families among others. The process of vetting these collections involves evaluation by our experts and the selection of only the highest-quality images available for download on the site. Such a wide variety of categories ensures our user's speed and efficiency in locating the ideal shots required for their upcoming promotions. Let our collections inspire you to celebrate the diversity of life.
Experience the latest free photos and added-value extras
Our modern online photo stock will impress you and your audience. Indulge in a daily update of the latest visual content and find an assortment of images that can only be found on our platform. Our complimentary gallery is home to over 100 pages of free pictures, across a wide range of themes, including happy families, packaging, and medical instruments, to name just a few. Read our blog posts for valuable advice and tips on how adding our stock photos to your work can boost the recall and interaction. These added value extras to our service are invaluable for marketers, designers, teachers, and anyone looking to enhance their projects.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
We provide a positive buying experience from start to finish
It doesn’t have to be difficult to find quality stock images online. We certainly don’t make it so with our user-friendly website and service offering. Users can select from Standard or Extended license on-demand pricing packs that reduce the price per individual image with the more you buy in bulk. You can compare the two license types to determine which one is needed based on your proposed image use. Some noteworthy differences of the Extended pack are that you will be allowed to use our content on products for sale or distribution, on digital templates for sale or distribution, and on any designs for business or commercial space.