Composition with CBD oil, THC tincture and hemp leaves on wooden table, flat lay. Space for text
Stock Photo ID: 765057
Large 6720 × 4480 px, JPG 237.07 × 158.04 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Composition with CBD oil, THC tincture and hemp leaves on wooden table, flat lay. Space for text”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 6720 × 4480 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 6 Jul 2021
You may use our image “Composition with CBD oil, THC tincture and hemp leaves on wooden table, flat lay. Space for text” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
alternativeanxietybackgroundbeautybodybottlecalmingcannabidiolcannabinoidcannabiscarecbdcompositioncopycosmeticcreamdropperdrugeffectextractflatgreenhealthhemplayleaveslegalizelotionmarijuanamedicalmedicinenaturalnatureobjectoilorganicpillplantproductskinspacestresssupplementtabletextthctincturetopviewwooden
Africa Images photo stock: where content creation comes to life
At Africa Images, we create compelling visual material to make a lasting impression on your audience. Our stock image collections are not only wide and varied, but we add new images every day to give you more choices. From beauty to DIY and gardening, we have royalty-free stock images, pictures, and illustrations that can help you in meeting your company’s goals. We keep up with the latest trends and popular content and create affordable photos that are perfect for any project, whether commercial or non-commercial. We are proud to be by your side, strengthening your brand awareness and ensuring your ongoing success.
Uncover the reflective power of stock photos for your business
High-resolution stock photos can provide a winning formula for developing an impactful marketing or advertising campaign, resulting in long-lasting impact and results for your business. High-quality stock images create a sense of emotion that will inspire users to connect with your content. These varied images serve as a useful resource for content creators who are interested in understanding how their target audience or readers will emotionally respond so that they can select the best and most appropriate pictures. Our royalty-free images will help make a deeper connection and create a greater impression on your audience for more effective engagement.
Boost your brand profile with our versatile image categories
Learn how we bring together stock images under various categories. No matter what topic or idea you are working on, we will have a suitable collection to fit. Themes may include everything from the simplicity of our daily routines to trending and popular topics such as interior design, sports, spas, food, holidays, and much more. Our collections are updated regularly, which means you are getting the most current visuals — helping you to keep ahead of the competition. Every one of our pictures is a work of art, selected with great attention to detail, providing you with something far above the average photo stock.
We offer the latest images plus helpful blog content and much more
Experience a world of exceptional photography with the ultimate photo stock. Get your designs looking modern and trendy with daily updated collections and a range of unique pictures that cannot be found on any other platform. Get inspired with our large free gallery full of diverse images and with filter options to help you source the ideal picture or illustration. Our blog provides content creators with all you need to know about how to make use of your new stock images, from styling tips to color psychology in marketing and promotional ideas. We have got you covered. This approach sets us apart from our competitors.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
We make using diverse and trendy images both fun and affordable
Give your budgets a boost when it comes to our on-demand image pricing plans. With one Standard license picture costing just $5, why not plan ahead with a bulk purchase of 10 images for a cost-saving total of $25? For those who need to do more with their downloads, where one image will set you back $65, take advantage of five Extended license pictures for just $295. Not only will this saving help you invest in other areas of your business, but it will also help with content planning for your upcoming campaigns. Browse our user-friendly, inspirational, and inexpensive website for all your stock photo needs.