
Comfortable armchair and rack near window with stylish curtains in room. Interior design
Stock Photo ID: 613852
Large 5632 × 3840 px, JPG 198.68 × 135.47 cm
Standard License
/ image
/ image
DescriptionImage Usage
Release info: property release for this stock photo is signed with Africa Studio.
What is an image “Comfortable armchair and rack near window with stylish curtains in room. Interior design”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 5632 × 3840 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.Upload date: 6 Nov 2020
You may use our image “Comfortable armchair and rack near window with stylish curtains in room. Interior design” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
apartmentarmchairbackgroundbeautifulbrownchairclothescomfortcomfortablecontemporarycozycurtainsdecordecorationdecorativedesigndrapeselegantelementfabricflatfloorfurniturehomehouseideaindoorsinteriorlamplifelifestylelightlivingluxurymirrormodernmorningnewnobodyobjectrackreflectionroomrugstylishtextilewallwhitewindowwooden
Bring your visual content to life with stock photos from Africa Images
At Africa Images, we offer a range of royalty-free stock pictures that are ideal for your upcoming projects. Among our large collection of images, you will find photos that are suitable for education, marketing, design, and advertising purposes in a variety of different sizes and resolutions. As well as galleries for different themes, including drinks, transportation, and seasons, our “Featured collections” section provides visual inspiration on popular photos recommended for use in your campaigns. Use Africa Images as your one-stop shop for constantly updated, high-quality visuals and exceptional service you can rely on to improve your promotions and sales.
Discover the transformative power of stock pictures for your campaigns
Pictures can alter how stories are told, brands are marketed, and communication is conducted in a world where conventional spaces blend with an ever-increasing digital presence. These aspects can surpass language barriers, stimulate feelings and emotions, and provide the highest engagement level. With a purchase of our licensed high-resolution stock photos, you can take confidence and pride in the fact that your creative integrity is protected along with that of the image creator. Discover our ever-evolving and growing stock photo resource for royalty-free visuals where each image is a storyteller, creating a lasting and memorable impression.
Immerse in a visual wonderland with exceptional photo collections
Go on an epic visual journey with our expansive stock photo categories that go from routine life moments to unexpected encounters and events. Discover hot topics around home interiors, holidays, happy families, and the freshest foods including healthy vegetables, as just a few examples. We take great care in curating our collections, selecting only superior quality and eye-catching images to feature on our site. Our goal is to provide you with the ultimate resource and inspiration for your projects. We ensure our collections are regularly updated so that your projects are current, and your business and creative endeavors outshine the competition.
Popular stock photos to help your business stand out from the crowd
Our photo stock is a highly respected and favored platform for sourcing high-quality visuals. With daily content updates, our users can stay one step ahead of the competition. Looking for unique images? A number of the pictures we have on our site are exclusive to this platform. In addition to this, we provide a free gallery with more than 100 pages of pictures which can be filtered according to what you are searching for. Visit our blog for practical advice on how to use stock photos in commercial and creative projects. Africa Images is where designers, bloggers, and marketers come to make an impact with our distinctive and inspiring photos.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
From finding your perfect image to making a payment, we make it easy
Time is precious, so why waste it looking at photo stock websites that don’t offer a great customer experience or quality visuals? On our platform, you can rest assured that our collections are not only regularly updated, but that the images available for purchase are cost-effective with one of our on-demand packs. Priced from just $5 for one image with our Standard option or $25 when downloading a bulk of 10 photos, there are savings to be made and more creativity to be unleashed in your work. Unsure what option you require? Check out our license comparison section for full clarity and reassurance.