
Color matching palette. Flat lay composition with ripe tangerines on yellow background, space for text
Stock Photo ID: 959619
Large 4167 × 4375 px, JPG 35.28 × 37.04 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Color matching palette. Flat lay composition with ripe tangerines on yellow background, space for text”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 4167 × 4375 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 22 Jul 2022
You may use our image “Color matching palette. Flat lay composition with ripe tangerines on yellow background, space for text” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
artbackgroundbeautifulcitrusclementinecollagecolorcombinationcomplimentarycompositioncontrastcopydesigndessertdifferentexoticflatfoodfreshfruitgreengrouphealthyingredientlayleavesmandarinmanymatchingnaturalobjectorangeorganicpaletteripeschemeshadespacesweettangerinestastytexttonetoptropicalvegetarianviewvitaminyellow
Bring your visual content to life with stock photos from Africa Images
At Africa Images, we offer a range of royalty-free stock pictures that are ideal for your upcoming projects. Among our large collection of images, you will find photos that are suitable for education, marketing, design, and advertising purposes in a variety of different sizes and resolutions. As well as galleries for different themes, including drinks, transportation, and seasons, our “Featured collections” section provides visual inspiration on popular photos recommended for use in your campaigns. Use Africa Images as your one-stop shop for constantly updated, high-quality visuals and exceptional service you can rely on to improve your promotions and sales.
Uncover the reflective power of stock photos for your business
High-resolution stock photos can provide a winning formula for developing an impactful marketing or advertising campaign, resulting in long-lasting impact and results for your business. High-quality stock images create a sense of emotion that will inspire users to connect with your content. These varied images serve as a useful resource for content creators who are interested in understanding how their target audience or readers will emotionally respond so that they can select the best and most appropriate pictures. Our royalty-free images will help make a deeper connection and create a greater impression on your audience for more effective engagement.
Transform your projects with creative imagery collections
Enhance your creative work with a huge collection of stock images that more than stand out from the crowd. There are a number of thematic categories, depending on whether you are looking for ordinary, everyday lifestyle pictures or something a little more different and unique. Regularly updated to stay current and relevant, our engaging image collections showcase modern and trending photos, including interior designs, happy families, holidays, fresh foods, and more; only the best visuals are selected and made available on the platform. With this high-quality photo stock, every picture can transform uninspiring and plain creatives to compelling visual stories.
Find out why we are the photo stock of choice for designers
Unlock your brand’s creative potential with our popular and trendy stock photo collections. Our platform users will receive a regular supply of daily updated visuals, which sets our service apart from other image providers. Take advantage of a free gallery featuring more than 100 pages of pictures across various subjects, with helpful filters so you can easily find the image you need. Our blog section is where we share information on the most efficient ways of using stock photos and illustrations in various business or personal projects. The addition of these extra features and benefits is our way of showing our loyal customers how important they are to us.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
Experience a buying journey like no other with our photo stock
Our website offers a slick user experience for ease and speed when browsing our vast collection of images so that you can concentrate on finding the perfect visuals for your projects without any obstacles. A review of our useful comparison table will outline what the Standard and Extended licenses can be used for when it comes to content creation, enabling you to choose what works best for you or your business. With one Standard high-resolution image costing a budget-friendly $5, it’s worth investing in 10 for only $25 to get a bulk saving and more pictures banked for your upcoming initiatives.