![Closed bottle of spray deodorant on white background Photo of Closed bottle of spray deodorant on white background](https://static.africaimages.com/photos/E/C/ECIsVneqZ4btWA1eb07BknNCV/ECIsVneqZ4btWA1eb07BknNCV_normal.jpg)
Closed bottle of spray deodorant on white background
Stock Photo ID: 481167
Large 3586 × 4765 px, JPG 126.51 × 168.1 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Closed bottle of spray deodorant on white background”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 3586 × 4765 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 15 Jul 2019
You may use our image “Closed bottle of spray deodorant on white background” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
aerosolantiperspirantaromaaromaticbackgroundbathroombeautybluebodybottlecarecleanclosedcontainercosmeticsdeodorantdermatologydesignemptyfragrancefragrantfreshhealthhygieneisolatedmalemanmockupnaturalobjectodororganicperfumepersonalplasticproductprotectionscentshowerskinsmellspacespraysweattemplatetoiletrywhite
Discover the latest and best-trending stock photos at Africa Images
Africa Studio — your home of exceptional pictures — brings you Africa Images, a handpicked selection of high-resolution stock photos compiled by our top photographers and creators. We offer a range of different sizes and resolutions so that you can find the perfect image for your projects. Our dedicated team constantly tracks recent trends and popular materials and updates our photo collections daily with the latest images. Our visuals will make your creative ideas come to life and help you have an unforgettable and engaging marketing campaign. Use our royalty-free images to increase your brand’s visibility and raise product demand.
Unravel the importance of ethical licensing with stock photography
When using stock images, you can have professional designs for your website, ads, brochures, and signs without breaking the bank or taking any legal risks. By downloading royalty-free pictures directly from our website, content creators can use them in all the ways accepted by our license agreements, including commercial use such as in marketing materials and more, legally. Whether you are looking for Standard or Extended license stock photography for your blog posts, billboards, social media pages, banners, promotional materials, or some other creative idea, you will find inspiring and engaging high-res images of all kinds at our photo stock.
Boost your brand profile with our versatile image categories
Learn how we bring together stock images under various categories. No matter what topic or idea you are working on, we will have a suitable collection to fit. Themes may include everything from the simplicity of our daily routines to trending and popular topics such as interior design, sports, spas, food, holidays, and much more. Our collections are updated regularly, which means you are getting the most current visuals — helping you to keep ahead of the competition. Every one of our pictures is a work of art, selected with great attention to detail, providing you with something far above the average photo stock.
Take advantage of our additional image services and benefits
Let our stock photographs take your business to the highest levels of excellence. Revel in daily updated images, which are available on our searchable and easy-to-navigate website. Browse our free gallery that contains a wide range of subjects from animals to toys and travel. Whatever the campaign theme or creative idea you are working on, we have the perfect image available in this complimentary collection. A read of our useful blog will provide essential advice on how to utilize stock photos in your work. These benefits are just some of the additional ways we reward our loyal customers for using our services.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
Get great savings when you buy in bulk from our photo stock
Not only is the process of finding quality images on our website quick, simple, and inspiring, but you will also be pleasantly surprised by our prices. It can be daunting when trying to navigate how image licenses work, but our useful comparison section outlines exactly what usage rights are included with our Standard and Extended on-demand pricing packs. With both options, the more pictures you purchase, the more value you will get with bulk savings. Wondering how you can maximize our content on popular printed reproductions and outdoor advertising? Then, the Extended license with unlimited use is the right choice for you.