
Clean plates, cutlery, napkin and lavender flowers on light grey textured table, closeup
Stock Photo ID: 1546666
Large 5760 × 3840 px, JPG 203.2 × 135.47 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Clean plates, cutlery, napkin and lavender flowers on light grey textured table, closeup”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 5760 × 3840 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 18 Dec 2023
You may use our image “Clean plates, cutlery, napkin and lavender flowers on light grey textured table, closeup” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
backgroundbanquetceramiccleanclearcloseupcrockerycutlerydecorationdesigndiningdinnerdinnerwaredishdishwareeatelegantemptyequipmentflatwareflowersfoodforkgoldengreykitchenkitchenwareknifelavenderlightluxurymealmetalnapkinobjectplaceplatesporcelainrestaurantserviceservingsetsettingspacestylishtabletablewaretexturedtoolutensil
Create memorable and engaging creative projects with Africa Images
Our goal at Africa Images is to create and supply exceptional stock images that will enhance your brand’s reputation. If you are a business owner or marketer, you understand that your advertising efforts require high-quality photography that can be used royalty-free in your creative campaigns. We can provide a range of sizes and resolutions, alongside a huge supply of themes and collections to ensure you find the perfect image. With additional benefits and service features, including free images, sharing previews, and unlimited downloads, now is the ideal time to enhance your brand visibility, drive engagement, and ultimately boost your sales.
The importance of the strategic use of stock photos in marketing
An important element that stock images can add to marketing campaigns is how people see themselves within your brand advert. Our vast and varied photo stock provides users with thousands of aspirational visuals your brand can tap into. These royalty-free images are a valuable resource for marketers, designers, bloggers, business owners, and anyone hoping to raise the quality of their content and creative output. A high-resolution photo can inspire and create motivation in the audience to become brand advocates and supporters. Take advantage of this opportunity to sell more of your products by strategically using our images to promote your brand.
Explore diversity in visuals with high-quality image collections
We are no ordinary photo stock. Our image categories depict a unique story with every picture. Think of a theme and we will have it. Browse through the latest trends in home decor inspiration, spa, and salon shots, as well as appealing food & drink snaps. As well as being modern, extensive, and of high quality, our collections are regularly updated, so we can guarantee you're always downloading the latest visuals. For your convenience, we also arrange these by category. To give our users a captivating and enriching visual experience, we carefully pick out only the most striking images for display.
Encounter a world of special imagery with our popular photo stock
Your visuals will always be cutting-edge with our fast-moving online photo stock. Relish fresh and original content accompanied by a free image gallery with over 100 pages covering different themes and topics, including sports, cosmetics, food, fashion, and much more. Take a read of our inspiring blog posts, where we offer handy hints and tips that can be used in business and creative campaigns to boost the power of stock images. So, if you are looking for high-quality images to enhance either your commercial or non-commercial projects, along with added benefits and service features, you have come to the right place.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
From finding your perfect image to making a payment, we make it easy
Time is precious, so why waste it looking at photo stock websites that don’t offer a great customer experience or quality visuals? On our platform, you can rest assured that our collections are not only regularly updated, but that the images available for purchase are cost-effective with one of our on-demand packs. Priced from just $5 for one image with our Standard option or $25 when downloading a bulk of 10 photos, there are savings to be made and more creativity to be unleashed in your work. Unsure what option you require? Check out our license comparison section for full clarity and reassurance.