
Chocolate Santa Claus candy in slightly open foil wrapper on light background, space for text
Stock Photo ID: 606311
Large 6720 × 4480 px, JPG 237.07 × 158.04 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Chocolate Santa Claus candy in slightly open foil wrapper on light background, space for text”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 6720 × 4480 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 1 Dec 2020
You may use our image “Chocolate Santa Claus candy in slightly open foil wrapper on light background, space for text” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
adventbackgroundblurredbokehcacaocandycelebratecelebrationchocolatechristmasclauscopydarkdecemberdecorationdecorativedeliciousdesserteatfestivefoilfoodgifthappylightmerrymilknewnicholasobjectopenpresentsaintsantaseasonseasonalslightlyspacesweettabletastytexttraditiontraditionaltreatwinterwrapperxmasyearyummy
Raise your brand awareness with Africa Images’ royalty-free visuals
At Africa Images — a part of Africa Studio, we take great pride in our superior standards not only for our services but also for the vast collection of royalty-free stock images available on our website. You will find individual image collections for fashion, lifestyle, or even tech, which are the perfect source of inspiration for those who are building websites, designing their marketing campaigns, and any artwork. We also provide additional features such as free images, the ability to share previews, and unlimited downloads, which make us popular amongst content creators. You can sell more of your products by promoting your brand and creating a powerful visual identity.
Why you should use highly visual stock images for business growth
Using visual content for marketing and advertising purposes helps to catch an audience’s attention, create an emotional response, increase shareability, and easily represent complex information in a more digestible and engaging way. The benefits would not only make your business and materials stand out in a competitive setting but would also fuel long-term growth. Our vast collection of royalty-free photos is relevant for any business and will provide content creators with ample choice and inspiration. Help bring your creative ideas to life and see the demand for your products and services grow with the help of our high-resolution stock images.
Craft excellence with a wide variety of stock photo categories
Explore our extensive collection of image categories that depict the intricacies of everyday life as well as more specialist subjects. In line with this commitment to our customers, we regularly update our collections and focus on presenting only high-quality photos and trending topics such as traveling, home décor, salons, spas, holidays, business, and more. Immerse yourself in collections that challenge existing standards of excellence in the stock photo industry. Each set of images represents an acknowledgment of this dedication to quality and ensures you get royalty-free images which will result in a new and enhanced look for your brand.
Encounter a world of special imagery with our popular photo stock
Your visuals will always be cutting-edge with our fast-moving online photo stock. Relish fresh and original content accompanied by a free image gallery with over 100 pages covering different themes and topics, including sports, cosmetics, food, fashion, and much more. Take a read of our inspiring blog posts, where we offer handy hints and tips that can be used in business and creative campaigns to boost the power of stock images. So, if you are looking for high-quality images to enhance either your commercial or non-commercial projects, along with added benefits and service features, you have come to the right place.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
The purchasing experience on our stock image platform is a standout
To keep customers happy in a competitive marketplace, we understand that their online experience must be seamless. This is why we have an intuitive website, designed and tailored to meet our users’ specific needs. From start to finish, the process of finding, purchasing, and downloading your chosen images is simple regardless of whether you’re coming to the site with an exact image in mind or with a creative idea to explore in more detail. Our handy license comparison summary will help you understand which type of on-demand pack you require (Standard or Extended) based on the image use and agreement terms.