
Child giving glass of water to elderly woman outdoors, closeup
Stock Photo ID: 1086937
Large 6000 × 4000 px, JPG 50.8 × 33.87 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Child giving glass of water to elderly woman outdoors, closeup”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 6000 × 4000 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 4 Oct 2022
You may use our image “Child giving glass of water to elderly woman outdoors, closeup” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
adultaquaassistancebackgroundbeverageboycarechildchildhoodcloseupdiseasedrinkelderlyenergyfamilyfemalegirlgivingglassgranddaughtergrandmagrandmothergrandparentgrandsongreenhandshealthhelpillkidlifelifestylelittlelovematureoldoutdoorspeoplepersonpureretirementseniorsicksupportthirstthirstytogetherwaterwoman
Create stunning visuals with Africa Images’ stock photography
Africa Images, a photo stock agency from Africa Studio, can help you meet your company goals with engaging, royalty-free images. Our team of experts keeps us updated on new trends and popular materials so that whatever may arise, you are always a step ahead. No matter whether your project is commercial or non-commercial, these professionally taken photographs will add that extra bit of quality. Our additional features, such as free photos, picture previews, and unlimited downloads, are all designed to help boost and enhance your creative ventures. Your marketing and advertising will be more effective with our high-resolution images, which will benefit your promotion, campaign performance, and, ultimately, sales.
Develop a responsible stock photo strategy for your brand
Understanding stock photos and how to use them responsibly doesn’t need to be confusing. Stock images, such as those on our website, have already been taken, edited and are ready to use. We then make them available for licensing, meaning content creators and businesses pay a fee to get the right to use the image in your designs and creative projects legally. With royalty-free images, this gives you a wide range of usage rights over one stock image for a cost-effective price. For both commercial and non-commercial projects, consider us as your visual partner in responsibly bolstering your creative output and sales.
Boost your brand profile with our versatile image categories
Learn how we bring together stock images under various categories. No matter what topic or idea you are working on, we will have a suitable collection to fit. Themes may include everything from the simplicity of our daily routines to trending and popular topics such as interior design, sports, spas, food, holidays, and much more. Our collections are updated regularly, which means you are getting the most current visuals — helping you to keep ahead of the competition. Every one of our pictures is a work of art, selected with great attention to detail, providing you with something far above the average photo stock.
An inspirational photo stock that goes beyond just images
Use a modern and impactful online photo stock that adds power to your visual storytelling. With new content added every day, you can find a selection of diverse and unique pictures only available on this platform. Explore our gallery, which is completely free and has subjects like home decor and business among the popular and current image trends. Our inspiring blog posts contain information, tips, and ideas for using stock photos in your business and extra-curricular activities. We offer the full package that will improve your brand’s creative output and appeal, while other image providers can only provide part of the overall experience.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
It’s secure and simple to find your ideal image on our website
Don’t you hate when you waste precious time searching online for stock images only to find the quality, user experience, payment processing, and poor customer service? That’s not the case with our photo stock. Alongside diverse image collections, easy website navigation, and payment protection at checkout, our on-demand pack options provide choices depending on your usage needs and, most importantly, cost savings when buying in bulk. Both the Standard and Extended licenses allow for our visual content to be used in digital reproductions, as well as personal non-commercial use. With Extended, you benefit from unlimited use in printed reproductions and outdoor advertising. You can also use this license type if you’re involved in designing business or commercial spaces, as well as in products for sale or distribution and digital templates for sale or distribution.