Casting call. Emotional woman performing on grey background
Stock Photo ID: 1526216
Large 8192 × 5464 px, JPG 289 × 192.76 cm
Standard License
/ image
/ image
DescriptionImage Usage
Release info: model release for this stock photo is signed with Africa Studio.
What is an image “Casting call. Emotional woman performing on grey background”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 8192 × 5464 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.Upload date: 29 Sep 2023
You may use our image “Casting call. Emotional woman performing on grey background” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
actingactoradultagencyauditionbackgroundbusinesscallcastcastingcauacsiancharactercinemacinematographyemotionalentertainmentexcitedfemalefilmfilmmakinggreyhappyindustryinterviewmovieoccupationperformanceperformingpersonplayprofessionrehearsalrolesceneshootingshowsmilingstagestudiotalenttechnologytheatertheatretvwomanworkyoung
Tell a visual story with Africa Images’ high-resolution photo stock
With high-quality stock photos that are updated daily, Africa Images will create a unique market presence for your brand. Our team knows the importance of having a professional business profile to enhance your reputation, and our royalty-free images will help you stand out from the competition. You can easily find animal, insurance, medical, or even finance photos, among others, on our website, which we have designed to be as user-friendly as possible. The dedicated team at Africa Images constantly monitors and tracks emerging trends and popular themes to guarantee that you will always be that one step ahead.
Learn how to navigate ethical stock image use for your brand
In a growing digital landscape, it’s important for businesses to understand the role and need for image licensing, copyright, and ethical practices. For creatives, finding the right picture to use is important, but at Africa Images, we believe it’s equally important to have moral and responsible image standards in place to safeguard both the user and creator. Every available picture you see on the website is made with integrity. It means that you have peace of mind that you have not only a high-quality image but one that respects creators’ rights. Discover the world of copyrighted images responsibly for your brand.
Looking for comprehensive stock image categories? You've found them
Ensure you take the time to go through the diverse imagery options in our exhaustive royalty-free collections. When it comes to categories, these include anything from everyday life events to trending interior design, happy families, fresh foods, and so much more. No matter what image you are looking for; we’ve got you covered from A to Z. Whatever topic or inspired idea for creativity; you will always be able to find suitable images which bring your thoughts and concepts to life. These carefully curated collections will contribute towards the overall aesthetic appeal, successful implementation, and engagement of your projects.
Take advantage of our additional image services and benefits
Let our stock photographs take your business to the highest levels of excellence. Revel in daily updated images, which are available on our searchable and easy-to-navigate website. Browse our free gallery that contains a wide range of subjects from animals to toys and travel. Whatever the campaign theme or creative idea you are working on, we have the perfect image available in this complimentary collection. A read of our useful blog will provide essential advice on how to utilize stock photos in your work. These benefits are just some of the additional ways we reward our loyal customers for using our services.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
We provide a pleasant shopping experience on our easy-to-use site
Browsing website after website online for the best stock images can be time-consuming and frustrating. That’s not the experience you will have with our platform. From start to end, you will find sourcing quality and diverse photos a breeze thanks to simple navigation and secure payment processing. Available in a Standard or Extended license form, our on-demand pricing packs offer great value for money, with savings to be made on the more pictures you download. We make it easy and clear to understand which type of license you will require based on how you plan to use your new visuals.