Bowl of delicious fruit smoothie with fresh blueberries, kiwi slices and coconut flakes isolated on white, top view
Stock Photo ID: 1199544
Large 4273 × 4350 px, JPG 150.74 × 153.46 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Bowl of delicious fruit smoothie with fresh blueberries, kiwi slices and coconut flakes isolated on white, top view”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 4273 × 4350 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 13 Oct 2022
You may use our image “Bowl of delicious fruit smoothie with fresh blueberries, kiwi slices and coconut flakes isolated on white, top view” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
antioxidantbackgroundblueberriesbowlbreakfastcerealcoconutcolorcookcookeddeliciousdessertdetoxdieteateatingenergyflakesfoodfreshfruitgourmetgreenhealthyhomemadeingredientsisolatedkiwilifestylemealmorningnutrientnutritionobjectrecipeslicessmoothiesnacksummersuperfoodtastytoptrendyveganviewvitaminswhiteyummy
Create visual excellence with Africa Images’ royalty-free photography
For content creators looking for high-resolution stock photos to enhance their creative projects, you’ve come to the right place. With our varied photo collections and illustrations that cover everything from happy families to drinks and pests, we can help your brand stand out. At our photo shoots, every single detail you see if carefully considered and styled, including any furniture, food, and technology. Our expert team of photographers, stylists, models, and re-touchers ensure the final product is of the highest quality before it is uploaded to our website. Along with daily updated collections, our additional benefits, such as preview sharing, free images, and unlimited downloads, mean that our cost-effective service will give you plenty of opportunities to increase the appeal and effectiveness of your campaigns.
Stock photographs can create a visual impact across industries
The correct use of visuals in business matters when it comes to the online environment. Amidst the constant information overloading and dwindling attention spans, businesses need to create unique ways through which they can catch and keep capturing the audience’s attention. We are proud to provide high-quality stock images, which include a variety of topics, themes, styles, and moods that help set the tone and build a connection between you and your audience. Irrespective of what industry you belong to, whether it is financial services, the cosmetics industry, or environmental studies, the ideal stock image can play a huge role in the interest and consideration of prospect customers.
Craft excellence with a wide variety of stock photo categories
Explore our extensive collection of image categories that depict the intricacies of everyday life as well as more specialist subjects. In line with this commitment to our customers, we regularly update our collections and focus on presenting only high-quality photos and trending topics such as traveling, home décor, salons, spas, holidays, business, and more. Immerse yourself in collections that challenge existing standards of excellence in the stock photo industry. Each set of images represents an acknowledgment of this dedication to quality and ensures you get royalty-free images which will result in a new and enhanced look for your brand.
Discover a photo stock where creativity meets uniqueness
Keep your creative projects on top with our daily updated photos. Take advantage of a selection of out-of-the-ordinary pictures and illustrations only available on this site, while checking out a free image gallery that includes a broad range of categories over 130 pages, including sports, food, cosmetics, and much more. Read our informative blog posts that give helpful hints and tips on how to better use our stock images in your business activities and design work. These are just some of the additional features and benefits of our photo stock service that are popular with business owners, marketers, designers, teachers, and bloggers.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
We offer flexible pricing plans to help you craft visual excellence
When it comes to finding not only the best quality but affordable images, we are the photo stock of choice. We offer cost-effective on-demand pricing plans that don't break the bank. Priced from only $5 per high-resolution image on our Standard license and a bulk saving when you purchase 10 images for $25, this will give you the opportunity to save in the long run and have more photos available when you need them for your upcoming campaigns. From browsing our collections for your desired pictures to purchasing and downloading them, we have made the process as smooth and as enjoyable as possible for the ultimate buyer experience.