
Bottles with different drinks and ingredients on table against color background. Space for text
Stock Photo ID: 294255
Large 6720 × 4480 px, JPG 237.07 × 158.04 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Bottles with different drinks and ingredients on table against color background. Space for text”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 6720 × 4480 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 31 Oct 2018
You may use our image “Bottles with different drinks and ingredients on table against color background. Space for text” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
appleassortedbackgroundbeverageblueblueberrybottlebottlesbrightcoldcolorcontainercopydesigndietdifferentdrinkdrinksflavourfreshfreshnessfruitfullglasshealthyingredientsjuicelidliquidmanymaterialnaturalobjectorganicpackagingpomegranateproductreciperefreshingsmoothiespacesweettabletastytextvariousvitaminwholesome
Bring your visual content to life with stock photos from Africa Images
At Africa Images, we offer a range of royalty-free stock pictures that are ideal for your upcoming projects. Among our large collection of images, you will find photos that are suitable for education, marketing, design, and advertising purposes in a variety of different sizes and resolutions. As well as galleries for different themes, including drinks, transportation, and seasons, our “Featured collections” section provides visual inspiration on popular photos recommended for use in your campaigns. Use Africa Images as your one-stop shop for constantly updated, high-quality visuals and exceptional service you can rely on to improve your promotions and sales.
Discover the transformative power of stock pictures for your campaigns
Pictures can alter how stories are told, brands are marketed, and communication is conducted in a world where conventional spaces blend with an ever-increasing digital presence. These aspects can surpass language barriers, stimulate feelings and emotions, and provide the highest engagement level. With a purchase of our licensed high-resolution stock photos, you can take confidence and pride in the fact that your creative integrity is protected along with that of the image creator. Discover our ever-evolving and growing stock photo resource for royalty-free visuals where each image is a storyteller, creating a lasting and memorable impression.
Enhance your creative output with our quality image collections
With a vast collection of stock image categories depicting different forms of life ranging from the ordinary to the out-of-the-ordinary, your business will be able to create intriguing visual narratives. No matter what idea you have in mind, we offer millions of modern photos readily accessible on our site, enabling ease in finding appropriate images for your upcoming projects. Search for popular and trending options in topics such as home interiors, happy families, salons, traveling, and holidays. With great care and consideration, we upload every image onto our platform and ensure that it raises the quality of your brand’s creative output.
Take advantage of our additional image services and benefits
Let our stock photographs take your business to the highest levels of excellence. Revel in daily updated images, which are available on our searchable and easy-to-navigate website. Browse our free gallery that contains a wide range of subjects from animals to toys and travel. Whatever the campaign theme or creative idea you are working on, we have the perfect image available in this complimentary collection. A read of our useful blog will provide essential advice on how to utilize stock photos in your work. These benefits are just some of the additional ways we reward our loyal customers for using our services.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
From finding your perfect image to making a payment, we make it easy
Time is precious, so why waste it looking at photo stock websites that don’t offer a great customer experience or quality visuals? On our platform, you can rest assured that our collections are not only regularly updated, but that the images available for purchase are cost-effective with one of our on-demand packs. Priced from just $5 for one image with our Standard option or $25 when downloading a bulk of 10 photos, there are savings to be made and more creativity to be unleashed in your work. Unsure what option you require? Check out our license comparison section for full clarity and reassurance.