Black leather dog leash isolated on white, top view
Stock Photo ID: 1215137
Large 5337 × 4042 px, JPG 188.28 × 142.59 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Black leather dog leash isolated on white, top view”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 5337 × 4042 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
You may use our image “Black leather dog leash isolated on white, top view” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
accessoryanimalbackgroundbeautifulblackcaninecarbinecarecarrycatclipcolorcontrolcutedesigndogdoggydomesticequipmentisolateditemleadleashleatherlifestylematerialnewnobodyobedienceobedientobjectonepetpuppysafetysinglestrapstylishtoptrainingtransporttransportationtraveltripvetveterinaryviewwalkwearwhite
Elevate your brand awareness with Africa Images’ stock photography
A subsidiary project of Africa Studio, Africa Images is distinctive by its ability to produce powerful visuals. We created something unique and inspiring in 2008 by combining an innovative stock photography approach with exceptional service performance. Our image library has collections for many trending and popular topics and is suitable for both commercial as well as non-commercial projects. These royalty-free images are an invaluable resource for marketers, designers, bloggers, business owners, and anyone hoping to raise the quality of their content. We can be a key partner in improving the impact of your marketing and advertisements by enhancing your brand’s creative output.
Safeguard your business with our royalty-free licensed visuals
As a reputed supplier of high-quality stock photography, business owners have peace of mind when it comes to sourcing and downloading licensed visuals from our site. Regardless of what you need photo content for, there are unlimited options for the pictures you get. As well as being high-resolution and versatile for promotional activities such as marketing, advertising, social media, and web design, our pictures promote responsible image use and will leave a lasting impact not only on your audience but also in licensing on the digital and traditional landscape. Discover today how your image choices will leave a positive legacy.
Find the best modern royalty-free image collections here
Use our imaginative stock image collections for inspiration and tell powerful stories. With regularly updated collections and millions of available images to browse and download, you will easily discover your perfect visuals. Discover the latest trending pictures showcasing the opulence of home interiors, the magnetism of a spa, laidback holiday vibes, and the fast-paced world of business. When clicking on your desired category, you will find the photo collections grouped by the same subject. Need to refine your search? Use our search page with the help of convenient filters and keywords. Delve into thoughtfully crafted collections that extend beyond aesthetics, sparking imagination for your campaigns.
Find out why we are the photo stock of choice for designers
Unlock your brand’s creative potential with our popular and trendy stock photo collections. Our platform users will receive a regular supply of daily updated visuals, which sets our service apart from other image providers. Take advantage of a free gallery featuring more than 100 pages of pictures across various subjects, with helpful filters so you can easily find the image you need. Our blog section is where we share information on the most efficient ways of using stock photos and illustrations in various business or personal projects. The addition of these extra features and benefits is our way of showing our loyal customers how important they are to us.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
Experience a buying journey like no other with our photo stock
Our website offers a slick user experience for ease and speed when browsing our vast collection of images so that you can concentrate on finding the perfect visuals for your projects without any obstacles. A review of our useful comparison table will outline what the Standard and Extended licenses can be used for when it comes to content creation, enabling you to choose what works best for you or your business. With one Standard high-resolution image costing a budget-friendly $5, it’s worth investing in 10 for only $25 to get a bulk saving and more pictures banked for your upcoming initiatives.