Free
Free image Beautiful young woman preparing toenails for pedicure on bed at home
Stock Photo ID: 1177921
Large 5760 × 3840 px, JPG 203.2 × 135.47 cm
DescriptionImage Usage
Release info: model and property release for this stock photo is signed with Africa Studio.
What is a free image “Beautiful young woman preparing toenails for pedicure on bed at home”? It's a perfect solution when your photography budget is limited! We offer a free high-quality stock photo that may be used for any non-commercial projects. You can download it without any charges on Africa Images photo stock in high resolution up to 5760 × 3840 px or even form your own free images collection with other pictures in it. Simply put the heart under every photo or illustration you like for an effortless review and match.Upload date: 23 Jan 2023
You may use our free image “Beautiful young woman preparing toenails for pedicure on bed at home” for advertising, social networks, websites, mobile applications, programs, electronic publishing, and mass media as long as you indicate the reference to an image source (website https://africaimages.com) and mention Africa Studio Company. It is prohibited to use this free image for commercial purposes, such as merchandise, product sale, and free distribution, or make it a part of your brand or make a business logo with them. It also should not be used for sending spam email campaigns, infringing property rights, or being a part of any illegal or immoral activities. In addition, this photo cannot be used in a political context or for selling tobacco and alcohol products. Find out more in our Free license agreement.
Find stock photos using keywords
adultalcoholbackgroundbarefootbeautifulbeautybedbedroombodycarecaucasiandrinkfeetfemalefootgirlhappyhomeindoorsladylifestylemakingnailnailpolishnailspamperingpedicurepersonpolishpreparingprettyrelaxrelaxationrobeseparatorssmilingstylestylishtoetoenailtoenailstooltreatmentweekendwellnesswinewomanyoung
Africa Images photo stock: where content creation comes to life
At Africa Images, we create compelling visual material to make a lasting impression on your audience. Our stock image collections are not only wide and varied, but we add new images every day to give you more choices. From beauty to DIY and gardening, we have royalty-free stock images, pictures, and illustrations that can help you in meeting your company’s goals. We keep up with the latest trends and popular content and create affordable photos that are perfect for any project, whether commercial or non-commercial. We are proud to be by your side, strengthening your brand awareness and ensuring your ongoing success.
Develop a responsible stock photo strategy for your brand
Understanding stock photos and how to use them responsibly doesn’t need to be confusing. Stock images, such as those on our website, have already been taken, edited and are ready to use. We then make them available for licensing, meaning content creators and businesses pay a fee to get the right to use the image in your designs and creative projects legally. With royalty-free images, this gives you a wide range of usage rights over one stock image for a cost-effective price. For both commercial and non-commercial projects, consider us as your visual partner in responsibly bolstering your creative output and sales.
Enhance your creative output with our quality image collections
With a vast collection of stock image categories depicting different forms of life ranging from the ordinary to the out-of-the-ordinary, your business will be able to create intriguing visual narratives. No matter what idea you have in mind, we offer millions of modern photos readily accessible on our site, enabling ease in finding appropriate images for your upcoming projects. Search for popular and trending options in topics such as home interiors, happy families, salons, traveling, and holidays. With great care and consideration, we upload every image onto our platform and ensure that it raises the quality of your brand’s creative output.
Find out why we are the photo stock of choice for designers
Unlock your brand’s creative potential with our popular and trendy stock photo collections. Our platform users will receive a regular supply of daily updated visuals, which sets our service apart from other image providers. Take advantage of a free gallery featuring more than 100 pages of pictures across various subjects, with helpful filters so you can easily find the image you need. Our blog section is where we share information on the most efficient ways of using stock photos and illustrations in various business or personal projects. The addition of these extra features and benefits is our way of showing our loyal customers how important they are to us.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
Choose from different pricing plans based on your visual needs
For content creators who are looking for the best stock images, as well as the most budget-friendly, you will find everything you need and more on our user-friendly platform. You can take advantage of the bulk savings on offer with both our Standard and Extended packages, which make it more cost-effective the more you buy. Unsure which license you need for your proposed image use? Our comparison section will give you all the guidance and confirmation you need when it comes to selecting your required package. Lucky enough to have a promotional code? Be sure to use it for even more savings.