![Beautiful young woman hanging bauble on Christmas tree at home Photo of Beautiful young woman hanging bauble on Christmas tree at home](https://static.africaimages.com/photos/A/b/AbrSUZcnUzMJdy38FQjaRJqK1/AbrSUZcnUzMJdy38FQjaRJqK1_normal.jpg)
Free
Free image Beautiful young woman hanging bauble on Christmas tree at home
Stock Photo ID: 1281269
Large 3840 × 5760 px, JPG 135.47 × 203.2 cm
DescriptionImage Usage
Release info: model and property release for this stock photo is signed with Africa Studio.
What is a free image “Beautiful young woman hanging bauble on Christmas tree at home”? It's a perfect solution when your photography budget is limited! We offer a free high-quality stock photo that may be used for any non-commercial projects. You can download it without any charges on Africa Images photo stock in high resolution up to 3840 × 5760 px or even form your own free images collection with other pictures in it. Simply put the heart under every photo or illustration you like for an effortless review and match.Upload date: 20 Jan 2023
You may use our free image “Beautiful young woman hanging bauble on Christmas tree at home” for advertising, social networks, websites, mobile applications, programs, electronic publishing, and mass media as long as you indicate the reference to an image source (website https://africaimages.com) and mention Africa Studio Company. It is prohibited to use this free image for commercial purposes, such as merchandise, product sale, and free distribution, or make it a part of your brand or make a business logo with them. It also should not be used for sending spam email campaigns, infringing property rights, or being a part of any illegal or immoral activities. In addition, this photo cannot be used in a political context or for selling tobacco and alcohol products. Find out more in our Free license agreement.
Find stock photos using keywords
adultatmospherebackgroundbaublebeautifulblurredcaucasiancelebratecelebratingcelebrationchristmascozydecemberdecordecoratingdecorationdresseventfemalefestivefirfunhanginghappyholidayhomeindoorskitchenlifestylelightsmerrynewnoelpersonportraitpreparationpreparingseasonseasonalsmilingtoytraditiontreeverticalwinterwintertimewomanxmasyearyoung
Africa Images: perfect photos for all your business and project needs
Africa Images is a leading high-quality stock photography provider. We change our collections every day by keeping track of trends and making sure current images are of interest to our valued customers. With a team of professionals, including designers, retouchers, and models working on photo shoots, attention is paid to every detail of the image down to the furniture, technology, and food shown. High-resolution images are extremely important for your marketing, advertising, business ventures or other commercial activities to convey a professional and credible reputation. Our royalty-free stock images will help you develop a positive corporate image, leading to increased sales.
Learn how to navigate ethical stock image use for your brand
In a growing digital landscape, it’s important for businesses to understand the role and need for image licensing, copyright, and ethical practices. For creatives, finding the right picture to use is important, but at Africa Images, we believe it’s equally important to have moral and responsible image standards in place to safeguard both the user and creator. Every available picture you see on the website is made with integrity. It means that you have peace of mind that you have not only a high-quality image but one that respects creators’ rights. Discover the world of copyrighted images responsibly for your brand.
Bring imagination to life with our impressive image collections
We have a wealth of stock images available in our ample choice of categories. Whether you are looking for visuals that highlight everyday life or are seeking trending images that include the latest interior designs, home décor, salons, and spas, we have a suitable picture in one of our collections. Every one of these images is carefully selected, which demonstrates our dedication to excellence in quality. These collections are updated on a regular basis so that there is no danger of your business falling behind the competition. Stimulate your mind by browsing our expertly curated selection of stock photos that have their own stories and will help take your work to the next level.
We offer the latest images plus helpful blog content and much more
Experience a world of exceptional photography with the ultimate photo stock. Get your designs looking modern and trendy with daily updated collections and a range of unique pictures that cannot be found on any other platform. Get inspired with our large free gallery full of diverse images and with filter options to help you source the ideal picture or illustration. Our blog provides content creators with all you need to know about how to make use of your new stock images, from styling tips to color psychology in marketing and promotional ideas. We have got you covered. This approach sets us apart from our competitors.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
Get better value for money with our affordable pricing plans
Purchasing high-resolution stock images should be easy to find, purchase, and download from an online supplier. That’s why we have budget-friendly on-demand Standard and Extended license packages that offer great value for money and bulk savings. Our Standard pack allows for our content to be used in digital and print reproductions, as well as outdoor advertising and personal non-commercial use. With Extended, you get all this and more with the ability to use our striking visuals in business or commercial designs, digital templates for sale and distribution, and products that are for sale or distribution.