
Beautiful young woman applying gloss on her perfect lips, closeup
Stock Photo ID: 274923
Large 5760 × 3840 px, JPG 203.2 × 135.47 cm
Standard License
/ image
/ image
DescriptionImage Usage
Release info: model release for this stock photo is signed with Africa Studio.
What is an image “Beautiful young woman applying gloss on her perfect lips, closeup”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 5760 × 3840 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.Upload date: 24 Sep 2018
You may use our image “Beautiful young woman applying gloss on her perfect lips, closeup” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
adultapplicatorapplyingartattractivebackgroundbeautifulbeautybrushcarecloseupcolorcosmeticcosmetologycreativedecorativedesignfacefacialfashionfemalegirlglamourglossglossyholidaykisslifestyleliplipslipstickmake-upmakeovermakeupmodelmouthnaturalnudeperfectpersonpinkplumpprettysexyskinstyletrendvoguewomanyoung
Africa Images: perfect photos for all your business and project needs
Africa Images is a leading high-quality stock photography provider. We change our collections every day by keeping track of trends and making sure current images are of interest to our valued customers. With a team of professionals, including designers, retouchers, and models working on photo shoots, attention is paid to every detail of the image down to the furniture, technology, and food shown. High-resolution images are extremely important for your marketing, advertising, business ventures or other commercial activities to convey a professional and credible reputation. Our royalty-free stock images will help you develop a positive corporate image, leading to increased sales.
Create visual resonance for your brand with royalty-free images
Visual resonance is when you make a person feel that they are in the image or fully experiencing it. When achieved, brand resonance can create an unprecedented level of advocacy among consumers who become not only buyers but also promoters and fans of the brand. A positive experience will help in laying a foundation for the establishment of long-lasting relationships with your brand. With an extensive collection of high-quality images available on our site, your visuals can portray the desired message to your targeted audience. Get your audience to be curious, and they will stay interested in your business for the long term.
Find the best modern royalty-free image collections here
Use our imaginative stock image collections for inspiration and tell powerful stories. With regularly updated collections and millions of available images to browse and download, you will easily discover your perfect visuals. Discover the latest trending pictures showcasing the opulence of home interiors, the magnetism of a spa, laidback holiday vibes, and the fast-paced world of business. When clicking on your desired category, you will find the photo collections grouped by the same subject. Need to refine your search? Use our search page with the help of convenient filters and keywords. Delve into thoughtfully crafted collections that extend beyond aesthetics, sparking imagination for your campaigns.
We offer helpful content as well as the latest stock images
Discover our extensive stock image collections to help improve your creative and artistic abilities. Here, you will find an endless supply of original content featuring several unique images that can only be found on our platform. Visit our free gallery, where content creators will find a vast supply of quality photos across a number of themes and styles. By using the helpful dropdown options, you will be able to find exactly what you are looking for. You can also learn valuable skills by reading our blog, which offers the latest tips and tricks on using stock images in business and other work endeavors.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
Save your precious funds with our stock image pricing bundles
From browsing our vast image collections to selecting, purchasing, and downloading, we make the process effortless for our valued customers. We understand that business owners and independent freelancers all want to save money where they can, which is why our affordable pricing plans offer greater value for money the more you buy. With our license comparison information, you can easily determine which on-demand pack you require for your commercial or non-commercial activities. All our content terms and conditions can also be helpfully found within our license agreement page for complete clarity and peace of mind when downloading from our site.