
Beautiful women using mattifying wipes on grey background
Stock Photo ID: 854614
Large 6720 × 4480 px, JPG 237.07 × 158.04 cm
Standard License
/ image
/ image
DescriptionImage Usage
Release info: model release for this stock photo is signed with Africa Studio.
What is an image “Beautiful women using mattifying wipes on grey background”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 6720 × 4480 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.Upload date: 2 Dec 2021
You may use our image “Beautiful women using mattifying wipes on grey background” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
absorbingadultattractivebackgroundbeautifulbeautyblottingcarecaucasiancleancolorcontrolcosmeticcosmeticsfacefacialfemaleflawlessfreshfreshnessgirlsglowgreyhairhappyhygienelifestylemakemakeupmattemattifyingmodelsoiloilypaperpeopleportraitproductrefreshingsheetshineskinsmilingtissuetreatmentupusingwipeswomenyoung
Create visual excellence with Africa Images’ royalty-free photography
For content creators looking for high-resolution stock photos to enhance their creative projects, you’ve come to the right place. With our varied photo collections and illustrations that cover everything from happy families to drinks and pests, we can help your brand stand out. At our photo shoots, every single detail you see if carefully considered and styled, including any furniture, food, and technology. Our expert team of photographers, stylists, models, and re-touchers ensure the final product is of the highest quality before it is uploaded to our website. Along with daily updated collections, our additional benefits, such as preview sharing, free images, and unlimited downloads, mean that our cost-effective service will give you plenty of opportunities to increase the appeal and effectiveness of your campaigns.
When it comes to crafting campaigns, images speak louder than words
Photography is everywhere, and it can make us think, connect, engage, act, and even stop in our tracks. Whether you are a business owner or a content creator looking to elevate your work, we believe that with the right image, you can convey more information than words. This is why we go to great lengths to ensure our photos are of the highest quality, showcasing the diversity of images available but also license options. If you want your audience to connect on a deeper level with your brand, our royalty-free images will compel them to explore further and convert.
Immerse in a visual wonderland with exceptional photo collections
Go on an epic visual journey with our expansive stock photo categories that go from routine life moments to unexpected encounters and events. Discover hot topics around home interiors, holidays, happy families, and the freshest foods including healthy vegetables, as just a few examples. We take great care in curating our collections, selecting only superior quality and eye-catching images to feature on our site. Our goal is to provide you with the ultimate resource and inspiration for your projects. We ensure our collections are regularly updated so that your projects are current, and your business and creative endeavors outshine the competition.
Our additional services make us a leading photo stock resource
You can rely on our photo stock to supply the latest and greatest high-quality images. Business owners, designers, marketers, and bloggers can discover a never-ending source of daily updated content with a variety of unique pictures only available here. Check out our free gallery featuring various themes that will provide plenty of visual inspiration for upcoming projects. You can select by orientation, image type, isolation, and color to find the perfect photo for your creative requirements. Read our blog posts to keep up to date on how best to use your newly downloaded stock images for business and artistic purposes.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
It’s all about the buying experience on our stock image platform
Nothing is more frustrating when you’re online shopping than a platform that is not user-friendly and does not offer value for money in return for the goods or services on offer. That’s where our trusted photo stock site differs from the rest. From easy navigation for finding your perfect images, to a hassle-free download and payment process, the buying experience is exceptional. Choose from Standard or Extended on-demand pricing plans that offer greater value for money on bulk purchases. Each license plan has a breakdown of what’s allowed in terms of image use, so you can determine which is the right option for you.