Beautiful woman with milk mustache holding glass of tasty dairy drink on light blue background
Stock Photo ID: 1634995
Large 6720 × 4480 px, JPG 237.07 × 158.04 cm
Standard License
/ image
/ image
DescriptionImage Usage
Release info: model release for this stock photo is signed with Africa Studio.
What is an image “Beautiful woman with milk mustache holding glass of tasty dairy drink on light blue background”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 6720 × 4480 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.Upload date: 19 Jan 2024
You may use our image “Beautiful woman with milk mustache holding glass of tasty dairy drink on light blue background” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
adultbackgroundbeautifulbeveragebiobluebreakfastcalciumcaucasiancopycowcreamdairydeliciousdessertdietdrinkfemalefreshglasshappyhealthholdingingredientlactoselifestylelightliquidmilkmodelmorningmustachenaturalnutrientnutritionorganicpasteurizedpersonproductproteinrefreshmentspacestudiotastytextvitaminwhitewomanyoghurtyoung
Africa Images: where quality and creativity come together in harmony
Our purpose at Africa Images is to provide our customers with the highest quality, royalty-free stock photos that will increase brand recognition and credibility. With a wide range of photography categories in our expansive collection, such as pests, religion, and gardening, we have images suitable for any project — whether it is commercial or non-commercial. Our pictures are available in different dimensions and resolutions so that they meet your creative requirements. To enhance and expand our services for content creators, we have included additional features and benefits, including unlimited downloads, free photos, and previews. The “Featured collections” gallery has endless inspiration for web designers, marketers, business owners, bloggers, and advertisers looking for trending and popular content.
Craft strong narratives with stock photos for visual storytelling
In the vast marketing and communications landscape, images can help to build brands, shape compelling narratives, and enhance creativity. They can say a thousand words without saying any words at all. Whether they are used on their own or to enhance content, imagery helps to elicit emotion, increase information retention, and make sense of complex situations. They can change the way an audience thinks, feels, and acts. With our extensive royalty-free images, content creators and business owners can push boundaries and craft memorable and inspiring dialogues, long remaining and capturing the hearts and minds of audiences. Find your brand’s visual narrative today.
Create magic with our expansive stock photography collections
Our varied range of image categories — from everyday scenes to highly specialized subjects — will keep you up to date with the latest visual and popular trends. With millions of images available on the platform, we are dedicated to offering the best possible royalty-free photos that meet the highest standards. In our regularly updated collections, you will see nothing but exceptional, beautiful pictures. Examine new trends in home interiors, salons, spas, businesses, and drinks, whose every category highlights the evolving landscape of visual storytelling. From A to Z, you will easily find the right images that reflect your brand vision and enhance your projects.
We offer the latest images plus helpful blog content and much more
Experience a world of exceptional photography with the ultimate photo stock. Get your designs looking modern and trendy with daily updated collections and a range of unique pictures that cannot be found on any other platform. Get inspired with our large free gallery full of diverse images and with filter options to help you source the ideal picture or illustration. Our blog provides content creators with all you need to know about how to make use of your new stock images, from styling tips to color psychology in marketing and promotional ideas. We have got you covered. This approach sets us apart from our competitors.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
Experience a buying journey like no other with our photo stock
Our website offers a slick user experience for ease and speed when browsing our vast collection of images so that you can concentrate on finding the perfect visuals for your projects without any obstacles. A review of our useful comparison table will outline what the Standard and Extended licenses can be used for when it comes to content creation, enabling you to choose what works best for you or your business. With one Standard high-resolution image costing a budget-friendly $5, it’s worth investing in 10 for only $25 to get a bulk saving and more pictures banked for your upcoming initiatives.