Beautiful woman making protein shake at wooden table indoors
Stock Photo ID: 2113399
Large 6720 × 4480 px, JPG 56.9 × 37.93 cm
Standard License
/ image
/ image
DescriptionImage Usage
Release info: model and property release for this stock photo is signed with Africa Studio.
What is an image “Beautiful woman making protein shake at wooden table indoors”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 6720 × 4480 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.Upload date: 19 Nov 2024
You may use our image “Beautiful woman making protein shake at wooden table indoors” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
adultamericanathleteathleticbackgroundbeautifulbeveragebiracialcocktaildeliciousdietdrinkenergyfemalefitnessflavorfoodgymhappyhealthyhomeindoorsjarlatinolifestylemakingmilknutritionpersonpowderproductproteinscoopshakeshakersmilingsportsportswomanstrongsuperfoodsupplementtabletakingtrainingvitaminwellnesswomanwoodenworkoutyoung
Propel your brand's success with Africa Images’ royalty-free photos
At Africa Images — a part of Africa Studio, we offer compelling visual content that will raise your brand profile and enhance your creative projects. Before we upload an image to one of our vast collections, a team of professionals, including designers, models, photographers, and experienced retouchers, pay special attention to even the small details like the furniture, food, and technology captured in a picture. By so doing, we create quality materials that will help to uniquely exemplify your brand. Our wide range of stock photos and graphics are designed exclusively to help achieve your company objectives, so think of Africa Images for all your commercial design needs.
The importance of the strategic use of stock photos in marketing
An important element that stock images can add to marketing campaigns is how people see themselves within your brand advert. Our vast and varied photo stock provides users with thousands of aspirational visuals your brand can tap into. These royalty-free images are a valuable resource for marketers, designers, bloggers, business owners, and anyone hoping to raise the quality of their content and creative output. A high-resolution photo can inspire and create motivation in the audience to become brand advocates and supporters. Take advantage of this opportunity to sell more of your products by strategically using our images to promote your brand.
Looking for comprehensive stock image categories? You've found them
Ensure you take the time to go through the diverse imagery options in our exhaustive royalty-free collections. When it comes to categories, these include anything from everyday life events to trending interior design, happy families, fresh foods, and so much more. No matter what image you are looking for; we’ve got you covered from A to Z. Whatever topic or inspired idea for creativity; you will always be able to find suitable images which bring your thoughts and concepts to life. These carefully curated collections will contribute towards the overall aesthetic appeal, successful implementation, and engagement of your projects.
Experience the latest free photos and added-value extras
Our modern online photo stock will impress you and your audience. Indulge in a daily update of the latest visual content and find an assortment of images that can only be found on our platform. Our complimentary gallery is home to over 100 pages of free pictures, across a wide range of themes, including happy families, packaging, and medical instruments, to name just a few. Read our blog posts for valuable advice and tips on how adding our stock photos to your work can boost the recall and interaction. These added value extras to our service are invaluable for marketers, designers, teachers, and anyone looking to enhance their projects.
Content creators can benefit from our dedicated customer support
Whether you are a business owner, teacher, blogger, or designer seeking stock photos for your website design or printed materials, you can find exactly what you need on our safe and secure platform. Along with implementing security measures, our photo stock adopts an approach that emphasizes quality control, to instill confidence and protect our customers. The site’s easy-to-use interface also makes it even quicker to find and download images. Additionally, our excellent customer service adds to the appeal — responding quickly to any queries from users. As the first-place choice in a rapidly changing and competitive industry, our security and user-friendly website navigation provides an improved user experience for consumers seeking the best online experience, as well as contemporary and high-quality stock photos.
Save your precious funds with our stock image pricing bundles
From browsing our vast image collections to selecting, purchasing, and downloading, we make the process effortless for our valued customers. We understand that business owners and independent freelancers all want to save money where they can, which is why our affordable pricing plans offer greater value for money the more you buy. With our license comparison information, you can easily determine which on-demand pack you require for your commercial or non-commercial activities. All our content terms and conditions can also be helpfully found within our license agreement page for complete clarity and peace of mind when downloading from our site.