
Beautiful succulents on grey table. Interior decoration
Stock Photo ID: 588317
Large 6720 × 4480 px, JPG 237.07 × 158.04 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Beautiful succulents on grey table. Interior decoration”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 6720 × 4480 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 30 Sep 2020
You may use our image “Beautiful succulents on grey table. Interior decoration” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
backgroundbeautifulbotanycactuscarecontemporarydecordecorationdecorativedesigndeskdifferentdomesticelementevergreenexoticfloralflowergardengiftgreengreygrouphipsterhobbyhomehousehouseplantindoorsinteriorjunglelifestylelightmanynapkinnaturenobodyobjectplantpotpottedroomrusticscandinavianstylishsucculentstabletrendytropicalwhite
Africa Images: the ultimate destination for royalty-free stock photos
Africa Images produces high-quality stock imagery designed to enhance your marketing and advertising endeavors. A detailed process is followed by our expert team before any image is posted on our website, including researching trending and popular materials. Our team of professionals arranges everything you can see in our high-resolution photos, including furniture, food, and technology. With a varied collection covering everything from Christmas to pregnancy and transportation, as well as a range of sizes and resolutions available, there’s a suitable image for all requirements. We offer cost-effective and royalty-free stock photography that will make your brand stand out from the crowd.
Create visual resonance for your brand with royalty-free images
Visual resonance is when you make a person feel that they are in the image or fully experiencing it. When achieved, brand resonance can create an unprecedented level of advocacy among consumers who become not only buyers but also promoters and fans of the brand. A positive experience will help in laying a foundation for the establishment of long-lasting relationships with your brand. With an extensive collection of high-quality images available on our site, your visuals can portray the desired message to your targeted audience. Get your audience to be curious, and they will stay interested in your business for the long term.
Looking for comprehensive stock image categories? You've found them
Ensure you take the time to go through the diverse imagery options in our exhaustive royalty-free collections. When it comes to categories, these include anything from everyday life events to trending interior design, happy families, fresh foods, and so much more. No matter what image you are looking for; we’ve got you covered from A to Z. Whatever topic or inspired idea for creativity; you will always be able to find suitable images which bring your thoughts and concepts to life. These carefully curated collections will contribute towards the overall aesthetic appeal, successful implementation, and engagement of your projects.
Benefit from constant new visual content with our photo stock
Trust us as a leading photo stock to help you produce modern, exciting, and highly engaging visual content using our latest and trending images. Be wowed with a continuous supply of daily updated contemporary and popular photos. Browse our free gallery, which showcases many themes and topics over 100 pages, and check out our blog posts with recommendations and top tips on how to use stock images in your marketing strategy or artistic endeavors. On top of our high-quality photos, these additional features and benefits of our service mean more value for money and creative inspiration for our valued users.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
Save your precious funds with our stock image pricing bundles
From browsing our vast image collections to selecting, purchasing, and downloading, we make the process effortless for our valued customers. We understand that business owners and independent freelancers all want to save money where they can, which is why our affordable pricing plans offer greater value for money the more you buy. With our license comparison information, you can easily determine which on-demand pack you require for your commercial or non-commercial activities. All our content terms and conditions can also be helpfully found within our license agreement page for complete clarity and peace of mind when downloading from our site.