Beautiful orange Monarch butterfly on plant outdoors, space for text
Stock Photo ID: 1115831
Large 5760 × 3840 px, JPG 203.2 × 135.47 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Beautiful orange Monarch butterfly on plant outdoors, space for text”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 5760 × 3840 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 25 Oct 2022
You may use our image “Beautiful orange Monarch butterfly on plant outdoors, space for text” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
animalbackgroundbeautifulbeautybiologyblurredbotanicalbrightbutterflycolorcolorfulcopydanainaedanausdaydecorativeentomologyenvironmentfaunaflowerflygardengreeninsectleavesmilkweedmonarchnaturenymphalidaeorangeoutdoorsplantplexippusroundseasonsinglespacespotsspottedspringsummersunnytexttigertropicalwhitewildwildlifewingwings
Africa Images photo stock: where content creation comes to life
At Africa Images, we create compelling visual material to make a lasting impression on your audience. Our stock image collections are not only wide and varied, but we add new images every day to give you more choices. From beauty to DIY and gardening, we have royalty-free stock images, pictures, and illustrations that can help you in meeting your company’s goals. We keep up with the latest trends and popular content and create affordable photos that are perfect for any project, whether commercial or non-commercial. We are proud to be by your side, strengthening your brand awareness and ensuring your ongoing success.
We are your go-to destination for ethical stock photography
We believe that stock images should be used with an awareness of copyright and ethics. That’s why all the pictures on our website are copyrighted, which means someone owns them. Content creators can buy a license to avoid any possible legal issues with the stock images they download. Meaning protection for you, as well as the image owner. We offer two types of licenses, a Standard and an Extended license, with each type clearly determining how the downloaded material can be used. Have peace of mind when exploring our visuals that our licensing ensures integrity with every single captivating photo.
Enhance your creative output with our quality image collections
With a vast collection of stock image categories depicting different forms of life ranging from the ordinary to the out-of-the-ordinary, your business will be able to create intriguing visual narratives. No matter what idea you have in mind, we offer millions of modern photos readily accessible on our site, enabling ease in finding appropriate images for your upcoming projects. Search for popular and trending options in topics such as home interiors, happy families, salons, traveling, and holidays. With great care and consideration, we upload every image onto our platform and ensure that it raises the quality of your brand’s creative output.
We offer helpful content as well as the latest stock images
Discover our extensive stock image collections to help improve your creative and artistic abilities. Here, you will find an endless supply of original content featuring several unique images that can only be found on our platform. Visit our free gallery, where content creators will find a vast supply of quality photos across a number of themes and styles. By using the helpful dropdown options, you will be able to find exactly what you are looking for. You can also learn valuable skills by reading our blog, which offers the latest tips and tricks on using stock images in business and other work endeavors.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
We make using diverse and trendy images both fun and affordable
Give your budgets a boost when it comes to our on-demand image pricing plans. With one Standard license picture costing just $5, why not plan ahead with a bulk purchase of 10 images for a cost-saving total of $25? For those who need to do more with their downloads, where one image will set you back $65, take advantage of five Extended license pictures for just $295. Not only will this saving help you invest in other areas of your business, but it will also help with content planning for your upcoming campaigns. Browse our user-friendly, inspirational, and inexpensive website for all your stock photo needs.