Beautiful lilac flowers in glass vase isolated on white
Stock Photo ID: 939726
Large 4031 × 3611 px, JPG 142.2 × 127.39 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Beautiful lilac flowers in glass vase isolated on white”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 4031 × 3611 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 16 May 2022
You may use our image “Beautiful lilac flowers in glass vase isolated on white” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
aromaaromaticbackgroundbeautifulbeautybloombloomingblossomblossomingbouquetbranchbunchcolordecordelicatedesigndifferentflorafloralflowerfloweringflowersfragrancefragrantfreshglassinflorescenceisolatedleaveslilacnaturenobodyobjectpetalsplantseasonseasonalspringspringtimesyringatwigvasevioletwaterwhite
Africa Images’ photo stock is the key to your visual success
The premium stock photo content available at Africa Images is always growing. All our images go through strenuous quality procedures to ensure they are of the highest quality before we upload them to our photo galleries. Our experts monitor trending and popular themes and, together with a team of models, photographers, stylists, and editors, carry out photo shoots that result in the exceptional visuals you see today on our site. Eye-catching imagery that attracts audiences is a crucial element that can help drive sales or improve brand awareness of your business, contributing greatly to business objectives. These royalty-free photos are particularly useful for designers, teachers, bloggers, marketers, and creators wanting to produce high-quality, professional content.
Why you should use highly visual stock images for business growth
Using visual content for marketing and advertising purposes helps to catch an audience’s attention, create an emotional response, increase shareability, and easily represent complex information in a more digestible and engaging way. The benefits would not only make your business and materials stand out in a competitive setting but would also fuel long-term growth. Our vast collection of royalty-free photos is relevant for any business and will provide content creators with ample choice and inspiration. Help bring your creative ideas to life and see the demand for your products and services grow with the help of our high-resolution stock images.
Craft excellence with a wide variety of stock photo categories
Explore our extensive collection of image categories that depict the intricacies of everyday life as well as more specialist subjects. In line with this commitment to our customers, we regularly update our collections and focus on presenting only high-quality photos and trending topics such as traveling, home décor, salons, spas, holidays, business, and more. Immerse yourself in collections that challenge existing standards of excellence in the stock photo industry. Each set of images represents an acknowledgment of this dedication to quality and ensures you get royalty-free images which will result in a new and enhanced look for your brand.
Our photo stock service offers more than just great images
Enhance your photography endeavors by using a leading online picture stock. Enjoy an endless stream of the latest trending content and an assortment of unique pictures you will not find anywhere else. You can also take advantage of our complimentary gallery, containing over 100 pages of free visuals on everything from flowers to hygiene, cooking, and much more. Learn how to properly use your downloaded stock images thanks to our blog section, which gives helpful hints, tips, and inspiration for styling, advertising, and marketing your designs. As a result of offering our users these additional features and benefits, our services stand out, so you will, too.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
The purchasing experience on our stock image platform is a standout
To keep customers happy in a competitive marketplace, we understand that their online experience must be seamless. This is why we have an intuitive website, designed and tailored to meet our users’ specific needs. From start to finish, the process of finding, purchasing, and downloading your chosen images is simple regardless of whether you’re coming to the site with an exact image in mind or with a creative idea to explore in more detail. Our handy license comparison summary will help you understand which type of on-demand pack you require (Standard or Extended) based on the image use and agreement terms.