
Beautiful blooming freesias in wicker basket against grey background, closeup
Stock Photo ID: 554011
Large 6720 × 4480 px, JPG 237.07 × 158.04 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Beautiful blooming freesias in wicker basket against grey background, closeup”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 6720 × 4480 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 16 Jun 2020
You may use our image “Beautiful blooming freesias in wicker basket against grey background, closeup” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
aromaaromaticbackgroundbasketbeautifulbeautybloombloomingbotanicalbotanybouquetbudcardcelebrationcloseupcolorcolorfuldelicatedifferenteasterflorafloralflowerflowersfragrantfreesiafreesiasfreshgentlegiftgreetinggreygroupholidaymanynatureobjectpetalpinkpostcardromanticseasonseasonalspacespringspringtimetenderwhitewickeryellow
Benefit from the visual variety and creativity of Africa Images
Africa Images offers a unique royalty-free stock photo service for content providers and business owners. Our images go through a rigorous QA process before we upload them to the website; additionally, our specialized team tracks the current trends and popular topics to provide various resources for users, such as the “Featured collections” gallery. From photographers to models, retouching artists, and stylists, our professional photo shoots cover even the smallest details, including the furniture, food, and technology shown in the photographs. We endeavor to enhance your brand by building trust and credibility, differentiating you from other competitors.
Learn how creators can navigate the image landscape responsibly
In an increasingly visual world, high-quality photos and illustrations are always in high demand. Content creators such as bloggers, marketers, and designers can greatly benefit from using stock photos, which can significantly enhance your projects. With our vast archive of ready-made images, using our services is one of the best ways to legally use licensed photos for your campaigns. These royalty-free images are cleared for commercial and non-commercial use and can be used across industries and creative formats such as billboards, social media, stationery, websites, and signage. Consider us as your visual partner in navigating the image landscape responsibility to boost your business opportunities.
Bring imagination to life with our impressive image collections
We have a wealth of stock images available in our ample choice of categories. Whether you are looking for visuals that highlight everyday life or are seeking trending images that include the latest interior designs, home décor, salons, and spas, we have a suitable picture in one of our collections. Every one of these images is carefully selected, which demonstrates our dedication to excellence in quality. These collections are updated on a regular basis so that there is no danger of your business falling behind the competition. Stimulate your mind by browsing our expertly curated selection of stock photos that have their own stories and will help take your work to the next level.
Revitalize your visual content with the latest stock images
Your go-to online photo stock provides the perfect place for you to immerse yourself in creativity. Enjoy a constant flow of fresh content, including a collection of unique photos not available elsewhere. We also have a huge free image gallery covering an array of topics whereas our blog gives you invaluable ideas, tactics, and techniques on how to use stock imagery for business and creative growth. These additional benefits and features of our service make us a popular choice for content creators and business owners alike to upgrade both commercial and non-commercial projects. Reap the rewards of using our site today and enjoy amazing new content for your campaigns.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
An amazing buying experience is what makes us a top photo stock
In today’s evolving and fast-paced business world, you need an image supplier who can give you the full user experience when it comes to sourcing, purchasing, and downloading the best quality stock photographs. That provider is us. We understand that time is money, so we designed our site with our users in mind for speedier and stress-free browsing navigation. Our on-demand pricing plans ensure value for money, particularly when it comes to buying in bulk. If you’re unsure which license is right for you, our helpful comparison data highlights the differences between our Standard and Extended plans so you can determine exactly what you need depending on how you plan to use your images.