
Beautiful African ostrich on road in safari park
Stock Photo ID: 1060360
Large 5760 × 3840 px, JPG 203.2 × 135.47 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Beautiful African ostrich on road in safari park”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 5760 × 3840 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 21 Sep 2022
You may use our image “Beautiful African ostrich on road in safari park” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
africaafricananimalanimalsareabackgroundbeautifulbeautybioparkbirdconservationcutedaydiscoveryexoticfaunagravellandscapelifelonglovelymexiconationalnatureneckobservationostrichoutdoorsoutsideparkpasturepathreserveroadsafarisavannasavannahskyspringsummertourtourismtraveltripvacationwildwildlifezoozoology
Africa Images: perfect photos for all your business and project needs
Africa Images is a leading high-quality stock photography provider. We change our collections every day by keeping track of trends and making sure current images are of interest to our valued customers. With a team of professionals, including designers, retouchers, and models working on photo shoots, attention is paid to every detail of the image down to the furniture, technology, and food shown. High-resolution images are extremely important for your marketing, advertising, business ventures or other commercial activities to convey a professional and credible reputation. Our royalty-free stock images will help you develop a positive corporate image, leading to increased sales.
Create visual resonance for your brand with royalty-free images
Visual resonance is when you make a person feel that they are in the image or fully experiencing it. When achieved, brand resonance can create an unprecedented level of advocacy among consumers who become not only buyers but also promoters and fans of the brand. A positive experience will help in laying a foundation for the establishment of long-lasting relationships with your brand. With an extensive collection of high-quality images available on our site, your visuals can portray the desired message to your targeted audience. Get your audience to be curious, and they will stay interested in your business for the long term.
Craft excellence with a wide variety of stock photo categories
Explore our extensive collection of image categories that depict the intricacies of everyday life as well as more specialist subjects. In line with this commitment to our customers, we regularly update our collections and focus on presenting only high-quality photos and trending topics such as traveling, home décor, salons, spas, holidays, business, and more. Immerse yourself in collections that challenge existing standards of excellence in the stock photo industry. Each set of images represents an acknowledgment of this dedication to quality and ensures you get royalty-free images which will result in a new and enhanced look for your brand.
Content creators love our additional image resources and services
Enter a world of visual perfection with our quality photo stock. We supply our platform users with a constant flow of new content, and some exclusive images they will not find anywhere else. Other advantages of our service include our large and free gallery containing over 100 pages of images, which can be filtered to find exactly what you need. Unsure how best to use your newly downloaded pictures? Our blog contains useful advice and tips on how to maximize them in both commercial and non-commercial projects. We don’t just offer the best images and value for money; we offer the full package.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
It’s secure and simple to find your ideal image on our website
Don’t you hate when you waste precious time searching online for stock images only to find the quality, user experience, payment processing, and poor customer service? That’s not the case with our photo stock. Alongside diverse image collections, easy website navigation, and payment protection at checkout, our on-demand pack options provide choices depending on your usage needs and, most importantly, cost savings when buying in bulk. Both the Standard and Extended licenses allow for our visual content to be used in digital reproductions, as well as personal non-commercial use. With Extended, you benefit from unlimited use in printed reproductions and outdoor advertising. You can also use this license type if you’re involved in designing business or commercial spaces, as well as in products for sale or distribution and digital templates for sale or distribution.