Baking dish with spaghetti squash on gray table, top view. Space for text
Stock Photo ID: 286414
Large 6720 × 4480 px, JPG 237.07 × 158.04 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Baking dish with spaghetti squash on gray table, top view. Space for text”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 6720 × 4480 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 22 Oct 2018
You may use our image “Baking dish with spaghetti squash on gray table, top view. Space for text” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
backgroundbakingcompositioncookingcopycourgettecucurbitculinarydeliciousdietdisheatfoodfreshgourdgourmetgrayhealthierhealthyingredientmicrowavenaturalnobodynutritionobjectorganicpastapumpkinrawreciperecipesripespacespaghettisquashtabletastytexttopuncookedveganvegetablevegetarianviewvitaminwholeyellow
Africa Images: stay relevant and up to date with the latest trends
At Africa Images, we pride ourselves on offering content creators the latest and most unique stock photos and visual services. Our daily updated image collections, which include trending and popular materials, are ideal for both commercial and non-commercial projects. If you are in marketing, advertising, or communications, these royalty-free pictures can improve your campaigns by raising brand awareness and driving sales. By monitoring and staying up to date with the latest trends, and offering a range of sizes and resolutions, we guarantee that with our distinct images, your company will stand out from its competitors and leave a lasting impression on your audience.
Uncover the reflective power of stock photos for your business
High-resolution stock photos can provide a winning formula for developing an impactful marketing or advertising campaign, resulting in long-lasting impact and results for your business. High-quality stock images create a sense of emotion that will inspire users to connect with your content. These varied images serve as a useful resource for content creators who are interested in understanding how their target audience or readers will emotionally respond so that they can select the best and most appropriate pictures. Our royalty-free images will help make a deeper connection and create a greater impression on your audience for more effective engagement.
Immerse in a visual wonderland with exceptional photo collections
Go on an epic visual journey with our expansive stock photo categories that go from routine life moments to unexpected encounters and events. Discover hot topics around home interiors, holidays, happy families, and the freshest foods including healthy vegetables, as just a few examples. We take great care in curating our collections, selecting only superior quality and eye-catching images to feature on our site. Our goal is to provide you with the ultimate resource and inspiration for your projects. We ensure our collections are regularly updated so that your projects are current, and your business and creative endeavors outshine the competition.
We offer the latest images plus helpful blog content and much more
Experience a world of exceptional photography with the ultimate photo stock. Get your designs looking modern and trendy with daily updated collections and a range of unique pictures that cannot be found on any other platform. Get inspired with our large free gallery full of diverse images and with filter options to help you source the ideal picture or illustration. Our blog provides content creators with all you need to know about how to make use of your new stock images, from styling tips to color psychology in marketing and promotional ideas. We have got you covered. This approach sets us apart from our competitors.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
Choose from different pricing plans based on your visual needs
For content creators who are looking for the best stock images, as well as the most budget-friendly, you will find everything you need and more on our user-friendly platform. You can take advantage of the bulk savings on offer with both our Standard and Extended packages, which make it more cost-effective the more you buy. Unsure which license you need for your proposed image use? Our comparison section will give you all the guidance and confirmation you need when it comes to selecting your required package. Lucky enough to have a promotional code? Be sure to use it for even more savings.