
Autumn season. Colorful maple leaves on light grey background, flat lay with space for text
Stock Photo ID: 1484839
Large 6720 × 4480 px, JPG 237.07 × 158.04 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Autumn season. Colorful maple leaves on light grey background, flat lay with space for text”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 6720 × 4480 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 1 Nov 2023
You may use our image “Autumn season. Colorful maple leaves on light grey background, flat lay with space for text” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
autumnautumnalbackgroundbeautifulbeautyborderbotanycolorcolorfulcompositioncopydecordecorationdecorativedefoliationdesigndryfallfallenflatflorafoliageframegoldgreygrouplayleafleafageleaveslightmanymaplenaturalnaturenovemberobjectoctoberorangeplantredseasonseptemberspacetextthanksgivingtoptreeviewyellow
Find visual inspiration for your creative projects at Africa Images
At Africa Images, we understand the importance of a stylish and attractive corporate identity, which is why we only create the highest-quality royalty-free stock photography. In addition to daily updates to our huge image collections and continuous monitoring of trending content and high-demand materials, we also offer additional services such as previews, free images, and unlimited downloads. This is what differentiates us from other stock photo companies. Whether it’s nature-related pictures, tableware, or fresh veggies, there’s an image and a size available on our user-friendly website. You can trust our professional photos to enhance your advertisement campaigns or promotions.
Safeguard your business with our royalty-free licensed visuals
As a reputed supplier of high-quality stock photography, business owners have peace of mind when it comes to sourcing and downloading licensed visuals from our site. Regardless of what you need photo content for, there are unlimited options for the pictures you get. As well as being high-resolution and versatile for promotional activities such as marketing, advertising, social media, and web design, our pictures promote responsible image use and will leave a lasting impact not only on your audience but also in licensing on the digital and traditional landscape. Discover today how your image choices will leave a positive legacy.
Craft excellence with a wide variety of stock photo categories
Explore our extensive collection of image categories that depict the intricacies of everyday life as well as more specialist subjects. In line with this commitment to our customers, we regularly update our collections and focus on presenting only high-quality photos and trending topics such as traveling, home décor, salons, spas, holidays, business, and more. Immerse yourself in collections that challenge existing standards of excellence in the stock photo industry. Each set of images represents an acknowledgment of this dedication to quality and ensures you get royalty-free images which will result in a new and enhanced look for your brand.
We offer helpful content as well as the latest stock images
Discover our extensive stock image collections to help improve your creative and artistic abilities. Here, you will find an endless supply of original content featuring several unique images that can only be found on our platform. Visit our free gallery, where content creators will find a vast supply of quality photos across a number of themes and styles. By using the helpful dropdown options, you will be able to find exactly what you are looking for. You can also learn valuable skills by reading our blog, which offers the latest tips and tricks on using stock images in business and other work endeavors.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
Get great savings when you buy in bulk from our photo stock
Not only is the process of finding quality images on our website quick, simple, and inspiring, but you will also be pleasantly surprised by our prices. It can be daunting when trying to navigate how image licenses work, but our useful comparison section outlines exactly what usage rights are included with our Standard and Extended on-demand pricing packs. With both options, the more pictures you purchase, the more value you will get with bulk savings. Wondering how you can maximize our content on popular printed reproductions and outdoor advertising? Then, the Extended license with unlimited use is the right choice for you.