![Aromatic green rosemary in pot on white background Photo of Aromatic green rosemary in pot on white background](https://static.africaimages.com/photos/A/t/AtB8Uq8Iurzta1L4wXzNqmneH/AtB8Uq8Iurzta1L4wXzNqmneH_normal.jpg)
Aromatic green rosemary in pot on white background
Stock Photo ID: 1242215
Large 6720 × 4480 px, JPG 237.07 × 158.04 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Aromatic green rosemary in pot on white background”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 6720 × 4480 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 18 Apr 2023
You may use our image “Aromatic green rosemary in pot on white background” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
aromaaromaticbackgroundbotanycloseupcondimentcookingculinarydecordeliciousdietedibleevergreenflavorfoodfragrantfreshgardeninggreengrowinggrowthhealthyherbherbalingredientkitchenleafleavesmedicinenaturalobjectorganicplantpotpotspottedrosemaryseasoningspacespicesprigtastetastytwigvitaminwhitewholesomewindowsill
Africa Images: perfect photos for all your business and project needs
Africa Images is a leading high-quality stock photography provider. We change our collections every day by keeping track of trends and making sure current images are of interest to our valued customers. With a team of professionals, including designers, retouchers, and models working on photo shoots, attention is paid to every detail of the image down to the furniture, technology, and food shown. High-resolution images are extremely important for your marketing, advertising, business ventures or other commercial activities to convey a professional and credible reputation. Our royalty-free stock images will help you develop a positive corporate image, leading to increased sales.
The importance of the strategic use of stock photos in marketing
An important element that stock images can add to marketing campaigns is how people see themselves within your brand advert. Our vast and varied photo stock provides users with thousands of aspirational visuals your brand can tap into. These royalty-free images are a valuable resource for marketers, designers, bloggers, business owners, and anyone hoping to raise the quality of their content and creative output. A high-resolution photo can inspire and create motivation in the audience to become brand advocates and supporters. Take advantage of this opportunity to sell more of your products by strategically using our images to promote your brand.
Let our quality image collections motivate your creativity
Embark on a visual tour of our many stock photo categories that bring out the unique aspects of everyday and not-so-everyday life. No matter what theme you are working on, or what idea you have in your mind, we will have a suitable image to fit your requirements in one of our extensive collections. From the most popular and trending categories to the daily essentials, these categories are regularly updated so that your materials are always up to date and stand out in a crowded marketplace. We celebrate the beauty of life with our diverse and carefully curated collections.
Stay ahead of visual trends and competitors with our photo stock
Take advantage of the services of a leading online photo stock and liberate your creativity. Explore a constant flow of new content with access to some exclusive images available only here. High-quality photos are always in high demand, with professionals benefitting from new and exciting images to use in their work — and ours are no exception. Visit our free image gallery containing over 100 pages of unique and inspiring free pictures and get updated on our blog, where we share useful information regarding how to use stock images for business growth and content creation. These are just some of the many benefits of our platform.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
Save your precious funds with our stock image pricing bundles
From browsing our vast image collections to selecting, purchasing, and downloading, we make the process effortless for our valued customers. We understand that business owners and independent freelancers all want to save money where they can, which is why our affordable pricing plans offer greater value for money the more you buy. With our license comparison information, you can easily determine which on-demand pack you require for your commercial or non-commercial activities. All our content terms and conditions can also be helpfully found within our license agreement page for complete clarity and peace of mind when downloading from our site.