Aromatic cinnamon sticks and green leaf isolated on white
Stock Photo ID: 1541451
Large 6182 × 3843 px, JPG 218.09 × 135.57 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Aromatic cinnamon sticks and green leaf isolated on white”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 6182 × 3843 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 25 Oct 2023
You may use our image “Aromatic cinnamon sticks and green leaf isolated on white” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
aromaaromatherapyaromaticbackgroundbakingbarkbrowncinnamoncondimentcookcookingculinarydecordeliciousdessertdietdryeatflavorfoodfreshgourmetgreengrouphealthyherbingredientisolatedleafmanymedicinenaturalnobodynutritionobjectorganicpowderscentscentedseasoningsmellspicestickstickssweettastetastyvegetarianwhitewhole
Africa Images: where quality and creativity come together in harmony
Our purpose at Africa Images is to provide our customers with the highest quality, royalty-free stock photos that will increase brand recognition and credibility. With a wide range of photography categories in our expansive collection, such as pests, religion, and gardening, we have images suitable for any project — whether it is commercial or non-commercial. Our pictures are available in different dimensions and resolutions so that they meet your creative requirements. To enhance and expand our services for content creators, we have included additional features and benefits, including unlimited downloads, free photos, and previews. The “Featured collections” gallery has endless inspiration for web designers, marketers, business owners, bloggers, and advertisers looking for trending and popular content.
Stock photographs can create a visual impact across industries
The correct use of visuals in business matters when it comes to the online environment. Amidst the constant information overloading and dwindling attention spans, businesses need to create unique ways through which they can catch and keep capturing the audience’s attention. We are proud to provide high-quality stock images, which include a variety of topics, themes, styles, and moods that help set the tone and build a connection between you and your audience. Irrespective of what industry you belong to, whether it is financial services, the cosmetics industry, or environmental studies, the ideal stock image can play a huge role in the interest and consideration of prospect customers.
Create magic with our expansive stock photography collections
Our varied range of image categories — from everyday scenes to highly specialized subjects — will keep you up to date with the latest visual and popular trends. With millions of images available on the platform, we are dedicated to offering the best possible royalty-free photos that meet the highest standards. In our regularly updated collections, you will see nothing but exceptional, beautiful pictures. Examine new trends in home interiors, salons, spas, businesses, and drinks, whose every category highlights the evolving landscape of visual storytelling. From A to Z, you will easily find the right images that reflect your brand vision and enhance your projects.
Find out why we are the photo stock of choice for designers
Unlock your brand’s creative potential with our popular and trendy stock photo collections. Our platform users will receive a regular supply of daily updated visuals, which sets our service apart from other image providers. Take advantage of a free gallery featuring more than 100 pages of pictures across various subjects, with helpful filters so you can easily find the image you need. Our blog section is where we share information on the most efficient ways of using stock photos and illustrations in various business or personal projects. The addition of these extra features and benefits is our way of showing our loyal customers how important they are to us.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
From payment to download, experience a seamless online journey
As a leading online supplier of stock images, users can experience great customer satisfaction from start to finish when it comes to downloading their chosen pictures. The process of finding exactly what you are looking for and comparing the different license plans available results in an enhanced purchase interaction. You can choose from a Standard or Extended on-demand pack depending on how you plan to use your new downloads. Both options also provide savings when purchasing in bulk. So not only is this more cost-effective but it means you can bank these additional photos for future use in your work initiatives.