Aerial view of countryside on sunny day
Stock Photo ID: 1128048
Large 5952 × 4480 px, JPG 209.97 × 158.04 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Aerial view of countryside on sunny day”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 5952 × 4480 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 17 Aug 2022
You may use our image “Aerial view of countryside on sunny day” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
aboveadventureaerialancientantiquearchitecturebackgroundbuildingcarscitycityscapecountrycountrysideculturedayeuropehillhistorichistoryhouseslandmarklandscapelifestylemountainnationalnatureobjectoutdoorspanoramicpicturesqueplantsrepublicroadsscenescenicstatestreetsunnytourtourismtowntraveltravelingtreestripurbanvacationview
Benefit from the visual variety and creativity of Africa Images
Africa Images offers a unique royalty-free stock photo service for content providers and business owners. Our images go through a rigorous QA process before we upload them to the website; additionally, our specialized team tracks the current trends and popular topics to provide various resources for users, such as the “Featured collections” gallery. From photographers to models, retouching artists, and stylists, our professional photo shoots cover even the smallest details, including the furniture, food, and technology shown in the photographs. We endeavor to enhance your brand by building trust and credibility, differentiating you from other competitors.
Uncover the reflective power of stock photos for your business
High-resolution stock photos can provide a winning formula for developing an impactful marketing or advertising campaign, resulting in long-lasting impact and results for your business. High-quality stock images create a sense of emotion that will inspire users to connect with your content. These varied images serve as a useful resource for content creators who are interested in understanding how their target audience or readers will emotionally respond so that they can select the best and most appropriate pictures. Our royalty-free images will help make a deeper connection and create a greater impression on your audience for more effective engagement.
Enhance your content campaigns with unique image categories
We have millions of photos that get updated regularly, so you can easily find the right photos that reflect your vision and perfectly illustrate your projects. You can browse, download, and purchase from the extensive collection of innovative, current, and trending stock images to stay one step ahead of the competition. From home interiors to spas and seasonal, no matter what business you work in, or your role, there’s plenty of choice and a variety of pictures available. For your convenience, all our stock photos are arranged by category, making it quicker to find exactly what you need for your initiatives.
We offer the latest images plus helpful blog content and much more
Experience a world of exceptional photography with the ultimate photo stock. Get your designs looking modern and trendy with daily updated collections and a range of unique pictures that cannot be found on any other platform. Get inspired with our large free gallery full of diverse images and with filter options to help you source the ideal picture or illustration. Our blog provides content creators with all you need to know about how to make use of your new stock images, from styling tips to color psychology in marketing and promotional ideas. We have got you covered. This approach sets us apart from our competitors.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
From finding your perfect image to making a payment, we make it easy
Time is precious, so why waste it looking at photo stock websites that don’t offer a great customer experience or quality visuals? On our platform, you can rest assured that our collections are not only regularly updated, but that the images available for purchase are cost-effective with one of our on-demand packs. Priced from just $5 for one image with our Standard option or $25 when downloading a bulk of 10 photos, there are savings to be made and more creativity to be unleashed in your work. Unsure what option you require? Check out our license comparison section for full clarity and reassurance.