![Adorable Cocker Spaniel in Christmas sweater on blurred background Photo of Adorable Cocker Spaniel in Christmas sweater on blurred background](https://static.africaimages.com/photos/c/a/cafDTZbej5x7Y6mWeCO5sXyfF/cafDTZbej5x7Y6mWeCO5sXyfF_normal.jpg)
Adorable Cocker Spaniel in Christmas sweater on blurred background
Stock Photo ID: 592825
Large 5760 × 3840 px, JPG 203.2 × 135.47 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Adorable Cocker Spaniel in Christmas sweater on blurred background”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 5760 × 3840 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 18 Nov 2020
You may use our image “Adorable Cocker Spaniel in Christmas sweater on blurred background” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
adorableanimalbackgroundbeautifulblurredcaninechristmasclothescockercompanioncutedecemberdogdoggydomesticfestivefloorfluffyfriendlyfunnyfurgreenhappyholidayhomehouseindoorsjumperknittedmammalmerrynewpawspedigreepedigreedpetportraitpurebredseasonalspanielstudiosweaterthoroughbreduglywarmwearwinterwoolenxmasyear
Create visual excellence with Africa Images’ royalty-free photography
For content creators looking for high-resolution stock photos to enhance their creative projects, you’ve come to the right place. With our varied photo collections and illustrations that cover everything from happy families to drinks and pests, we can help your brand stand out. At our photo shoots, every single detail you see if carefully considered and styled, including any furniture, food, and technology. Our expert team of photographers, stylists, models, and re-touchers ensure the final product is of the highest quality before it is uploaded to our website. Along with daily updated collections, our additional benefits, such as preview sharing, free images, and unlimited downloads, mean that our cost-effective service will give you plenty of opportunities to increase the appeal and effectiveness of your campaigns.
Learn how to navigate ethical stock image use for your brand
In a growing digital landscape, it’s important for businesses to understand the role and need for image licensing, copyright, and ethical practices. For creatives, finding the right picture to use is important, but at Africa Images, we believe it’s equally important to have moral and responsible image standards in place to safeguard both the user and creator. Every available picture you see on the website is made with integrity. It means that you have peace of mind that you have not only a high-quality image but one that respects creators’ rights. Discover the world of copyrighted images responsibly for your brand.
Discover diverse image categories for every creative need
We have developed an impressive collection of stock photo categories that cover aspects of people’s everyday lives up to niche ideas and events to help you keep track of visual trends. By providing exceptional curated images that inspire and spark a positive response from your audience, we reflect the quality standard we observe. Our user-friendly filters and keyword functions can be used on our search page to further refine your results. Discover different aspects of popular home interiors, salons, birthday celebrations, drinks, and other themes that reflect the changes in modern visuals. Make use of these vast photo collections to upgrade your projects and add a touch of style to your brand story in the form of imagery.
We offer helpful content as well as the latest stock images
Discover our extensive stock image collections to help improve your creative and artistic abilities. Here, you will find an endless supply of original content featuring several unique images that can only be found on our platform. Visit our free gallery, where content creators will find a vast supply of quality photos across a number of themes and styles. By using the helpful dropdown options, you will be able to find exactly what you are looking for. You can also learn valuable skills by reading our blog, which offers the latest tips and tricks on using stock images in business and other work endeavors.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
Get better value for money with our affordable pricing plans
Purchasing high-resolution stock images should be easy to find, purchase, and download from an online supplier. That’s why we have budget-friendly on-demand Standard and Extended license packages that offer great value for money and bulk savings. Our Standard pack allows for our content to be used in digital and print reproductions, as well as outdoor advertising and personal non-commercial use. With Extended, you get all this and more with the ability to use our striking visuals in business or commercial designs, digital templates for sale and distribution, and products that are for sale or distribution.